PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 678455325
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Utricularia
Family NF-YB
Protein Properties Length: 335aa    MW: 35683.3 Da    PI: 6.7318
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
678455325genomeUGSPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB183.22.2e-5719114297
      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                +eqdrflPianvsrimkk+lPanakiskdaketvqecvsefisfvt+easdkcqrekrkt+ngddllwa++tlGfe+yveplkvyl kyre+egek
  678455325  19 KEQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTVNGDDLLWAMTTLGFEEYVEPLKVYLGKYREMEGEK 114
                89*******************************************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.0E-5312118IPR009072Histone-fold
SuperFamilySSF471132.02E-3921120IPR009072Histone-fold
PfamPF008082.3E-272488IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.8E-205270No hitNo description
PROSITE patternPS0068505571IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.8E-207189No hitNo description
PRINTSPR006152.8E-2090108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MADSENDSGG YNNSNSSNKE QDRFLPIANV SRIMKKALPA NAKISKDAKE TVQECVSEFI  60
SFVTGEASDK CQREKRKTVN GDDLLWAMTT LGFEEYVEPL KVYLGKYREM EGEKISSGGS  120
EDGGAAVNSV GGVVIGGGIY GASAMDYHHA GNVYGGAEAA DAFQRVHGAG TGRGFVAKRT  180
SPCSCSNSKF ATSDEASIHS ISRLATATER PKFAVSPGGV VVAGAELNHG DVAGFLPVEL  240
GLLPGIALLH LISAATDSRG LSHLLHYSPF LPLIIFTRRI SSLSYLLKVC GPLLLPQFSR  300
VGHETCSCVG LFSLLHISFG PTEQHNNNQI PDFRP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-4619109292Transcription factor HapC (Eurofung)
4g92_B1e-4619109292Transcription factor HapC (Eurofung)
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011100345.12e-81PREDICTED: nuclear transcription factor Y subunit B-3-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11124356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.15e-64nuclear factor Y, subunit B3